PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002440G0410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB_related
Protein Properties Length: 239aa    MW: 26763.3 Da    PI: 6.3931
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002440G0410genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.2e-161660147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rW +eE+e+++da  ++G + Wk+I +++g ++t  q++s+ qky
  PH01002440G0410 16 RERWAAEEHERFLDALLMFGRD-WKKIEEHVG-TKTTIQIRSHAQKY 60
                     78******************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.96E-171066IPR009057Homeodomain-like
PROSITE profilePS5129418.4911165IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-81367IPR009057Homeodomain-like
TIGRFAMsTIGR015577.5E-171463IPR006447Myb domain, plants
SMARTSM007177.8E-101563IPR001005SANT/Myb domain
PfamPF002492.2E-121660IPR001005SANT/Myb domain
CDDcd001678.62E-81861No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MPGKKARKPY TITKPRERWA AEEHERFLDA LLMFGRDWKK IEEHVGTKTT IQIRSHAQKY  60
FLKVQKLGLA AGLPPQYPRG SSVSECFSDM QNFDWAGTSG ASAWGNHGAE SQAEQAATYP  120
GGNSFMGTPS FSNMSMDWTG STSEASAIGD EQYETIQLPL SPDDLHFAQV YRFIGDIFDP  180
NTPCPIEAHL QKLKDMDDIT VKTGLLYSHN VSECLALYFM FVKRILIVTC TEGCLYWK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646001.11e-104PREDICTED: protein REVEILLE 8
TrEMBLA0A0D3EJS81e-108A0A0D3EJS8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA002364-PA1e-107(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.16e-48MYB_related family protein